Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGFA Peptide - C-terminal region

VEGFA Peptide - C-terminal region

Product Specifications

Product Name Alternative

Name=VEGFA

UniProt

P15692

Field of Research

Cardiovascular Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VEGFA Rabbit Polyclonal Antibody (orb584861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ARL11 Antibody (OTI1A5) [DyLight 755]
NBP2-72348IR 0.1 mL

Mouse Monoclonal ARL11 Antibody (OTI1A5) [DyLight 755]

Sign In for Pricing
View Details
TMEM192 (F-12) Alexa Fluor® 546
sc-518207 AF546 200 µg/mL

TMEM192 (F-12) Alexa Fluor® 546

Sign In for Pricing
View Details
3-Chloro-4,5-difluorophenylboronic acid
PC901643 250 mg

3-Chloro-4,5-difluorophenylboronic acid

Sign In for Pricing
View Details
Mouse Monoclonal anti-human JAM-C
hAP-0426 100 µg

Mouse Monoclonal anti-human JAM-C

Sign In for Pricing
View Details
Rabbit Polyclonal CTRP7 Antibody [mFluor Violet 450 SE]
NBP1-76635MFV450 0.1 mL

Rabbit Polyclonal CTRP7 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Bonzo (CXCR6) Human Gene Knockout Kit (CRISPR)
KN406517 1 Kit

Bonzo (CXCR6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details