Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBCE Peptide - C-terminal region

TBCE Peptide - C-terminal region

Product Specifications

Product Name Alternative

TBCE

UniProt

Q15813

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBCE Rabbit Polyclonal Antibody (orb585104) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003184

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interferon-Gamma (IFN-γ)
EL10024-6 3x 192 Well

Interferon-Gamma (IFN-γ)

Sign In for Pricing
View Details
TRAF-5 Antibody Blocking Peptide - (Dry Ice)
NB100-56178PEP 0.1 mg

TRAF-5 Antibody Blocking Peptide - (Dry Ice)

Sign In for Pricing
View Details
VN1R61P ORF Vector (Human) (pORF)
ORF035746 1.0 µg DNA

VN1R61P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human C12orf45, GST-tagged
C12orf45-10371H 25 µg

Recombinant Human C12orf45, GST-tagged

Sign In for Pricing
View Details
CCDC129 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-8107R-BF750 100 µL

CCDC129 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse Protein Wnt-3a (Wnt3a), partial
MBS9020257-01 0.02 mg (E-Coli)

Recombinant Mouse Protein Wnt-3a (Wnt3a), partial

Sign In for Pricing
View Details