Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBCE Peptide - C-terminal region

TBCE Peptide - C-terminal region

Product Specifications

Product Name Alternative

TBCE

UniProt

Q15813

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBCE Rabbit Polyclonal Antibody (orb585104) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003184

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Rb (Thr 826) Rabbit mAb
C06670-100uL*2 2x 100μL

Phospho-Rb (Thr 826) Rabbit mAb

Sign In for Pricing
View Details
Goat anti-MICS1/GHITM (aa117-127) Antibody
MBS422287-01 0.1 mg

Goat anti-MICS1/GHITM (aa117-127) Antibody

Sign In for Pricing
View Details
Goat anti-MICS1/GHITM (aa117-127) Antibody
MBS422287-02 5x 0.1 mg

Goat anti-MICS1/GHITM (aa117-127) Antibody

Sign In for Pricing
View Details
SLC35E2 3'UTR Lenti-reporter-Luc Vector
44143081 1.0 µg

SLC35E2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rat Annexin A2 (Anxa2) ELISA Kit
GA-E0466RT-01 48 Tests

Rat Annexin A2 (Anxa2) ELISA Kit

Sign In for Pricing
View Details
Rat Annexin A2 (Anxa2) ELISA Kit
GA-E0466RT-02 96 Tests

Rat Annexin A2 (Anxa2) ELISA Kit

Sign In for Pricing
View Details