TEX101 Peptide - middle region
TEX101 Peptide - middle region
Product Specifications
Product Name Alternative
TEX101, SGRG, UNQ867/PRO1884
UniProt
Q9BY14
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TEX101 Rabbit Polyclonal Antibody (orb585211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_113639
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15106998 1 Vial
Lentiviral human AKIRIN1 shRNA (UAS) - Lentiviral human AKIRIN1 shRNA (UAS) (100)
Sign In for Pricing
View Details 
K6294403 1.0 µg DNA
Krt42 sgRNA CRISPR Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details 