Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX101 Peptide - middle region

TEX101 Peptide - middle region

Product Specifications

Product Name Alternative

TEX101, SGRG, UNQ867/PRO1884

UniProt

Q9BY14

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX101 Rabbit Polyclonal Antibody (orb585211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113639

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Sonic hedgehog protein (SHH) ELISA Kit
RK08781 96 Tests

Rat Sonic hedgehog protein (SHH) ELISA Kit

Sign In for Pricing
View Details
MFSD3 Peptide
orb2014043 100 µg

MFSD3 Peptide

Sign In for Pricing
View Details
TSHB Antibody
orb607775-01 20 µg

TSHB Antibody

Sign In for Pricing
View Details
TSHB Antibody
orb607775-02 100 µg

TSHB Antibody

Sign In for Pricing
View Details
TSHB Antibody
orb607775-03 100 ug (without BSA)

TSHB Antibody

Sign In for Pricing
View Details
N-Ethylglycine
MBS3848430-01 250 mg

N-Ethylglycine

Sign In for Pricing
View Details