Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISOC1 Peptide - C-terminal region

ISOC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ISOC1, CGI-111

UniProt

Q96CN7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ISOC1 Rabbit Polyclonal Antibody (orb586691) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057132

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arachidonic Acid, >97%
TRC-A765000-10MG 10 mg

Arachidonic Acid, >97%

Sign In for Pricing
View Details
SUV39H1 (NM_003173) Human Over-expression Lysate
LY418862 100 µg

SUV39H1 (NM_003173) Human Over-expression Lysate

Sign In for Pricing
View Details
Ethyl 6-(4-Chlorophenoxy)hexanoate
TRC-B126018-500MG 500 mg

Ethyl 6-(4-Chlorophenoxy)hexanoate

Sign In for Pricing
View Details
Human Transthyretin/TTR, Tag Free
HA211085-01 Inquire

Human Transthyretin/TTR, Tag Free

Sign In for Pricing
View Details
Human Transthyretin/TTR, Tag Free
HA211085-02 100 µg

Human Transthyretin/TTR, Tag Free

Sign In for Pricing
View Details
MIR549 Human qPCR Primer Pair (MI0003679)
HP300462 200 Reactions

MIR549 Human qPCR Primer Pair (MI0003679)

Sign In for Pricing
View Details