ISOC1 Peptide - C-terminal region
ISOC1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ISOC1, CGI-111
UniProt
Q96CN7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ISOC1 Rabbit Polyclonal Antibody (orb586691) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057132
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882885-100 1x 100 µL
CD81 / TAPA-1 (C81/2885R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GP-5001-40 1 mL
Colloidal Gold Conjugated Agaricus bisporus Lectin (Mushroom) -ABA-, 40nm
Sign In for Pricing
View Details 
BNC941742-500 1x 500 µL
Epstein-Barr Virus (LMP-1) (CS2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 