CDKL1 Peptide - C-terminal region
CDKL1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CDKL1
UniProt
Q00532
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDKL1 Rabbit Polyclonal Antibody (orb586782) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005268214
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
035794-ML405 100 µL
FUS, CT (FUS, TLS, RNA-binding protein FUS, 75kD DNA-pairing protein, Oncogene FUS, Oncogene TLS, POMp75, Translocated in liposarcoma protein) (MaxLight 405) discontinued
Sign In for Pricing
View Details 135197 100 µg
VAMP 1 (Vesicle Associated Membrane Protein 1, Vesicle-associated Membrane Protein 1, VAMP1, VAMP-1, DKFZp686H12131, Synaptobrevin 1, Synaptobrevin-1, SYB1, SYB-1, DKFZp686H12131)
Sign In for Pricing
View Details 