Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKL1 Peptide - C-terminal region

CDKL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDKL1

UniProt

Q00532

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDKL1 Rabbit Polyclonal Antibody (orb586782) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005268214

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Geminin Antibody (GMNN/3665) [HRP]
NBP3-14128H 0.1 mL

Mouse Monoclonal Geminin Antibody (GMNN/3665) [HRP]

Sign In for Pricing
View Details
Human MutY Homolog (MUTYH) ELISA Kit
DLR-MUTYH-Hu-01 48 Tests

Human MutY Homolog (MUTYH) ELISA Kit

Sign In for Pricing
View Details
Human MutY Homolog (MUTYH) ELISA Kit
DLR-MUTYH-Hu-02 96 Tests

Human MutY Homolog (MUTYH) ELISA Kit

Sign In for Pricing
View Details
Orbi-Shaker™ MP with 4 position micro plate platform, 100-240V (US Plug)
BT1502 1 Each

Orbi-Shaker™ MP with 4 position micro plate platform, 100-240V (US Plug)

Sign In for Pricing
View Details
Wipf1 ORF Vector (Rat) (pORF)
ORF079144 1.0 µg DNA

Wipf1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
EEF1A1 Antibody
orb2678096-01 50 µL

EEF1A1 Antibody

Sign In for Pricing
View Details