Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL22A1 Peptide - N-terminal region

COL22A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

COL22A1

UniProt

Q8NFW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL22A1 Rabbit Polyclonal Antibody (orb326664) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005250867

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGGGCQAQRAGCKSVHYDLVFLLDTSSSVGKEDFEKVRQWVANLVDTFEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM82B Recombinant Protein (Human)
RP011701 100 µg

FAM82B Recombinant Protein (Human)

Sign In for Pricing
View Details
Hsa-miR-588 miRNA Inhibitor
orb1873145-01 10 nmol

Hsa-miR-588 miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-588 miRNA Inhibitor
orb1873145-02 20 nmol

Hsa-miR-588 miRNA Inhibitor

Sign In for Pricing
View Details
Anti-Ataxin-1 Antibody
orb1148569 100 µg

Anti-Ataxin-1 Antibody

Sign In for Pricing
View Details
TMEM101 Adenovirus (Mouse)
46854054 1.0 mL

TMEM101 Adenovirus (Mouse)

Sign In for Pricing
View Details
Dtnb (NM_007886) Mouse Untagged Clone
MC219493 10 µg

Dtnb (NM_007886) Mouse Untagged Clone

Sign In for Pricing
View Details