Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL22A1 Peptide - N-terminal region

COL22A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

COL22A1

UniProt

Q8NFW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL22A1 Rabbit Polyclonal Antibody (orb326664) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005250867

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGGGCQAQRAGCKSVHYDLVFLLDTSSSVGKEDFEKVRQWVANLVDTFEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-ZEB1 Antibody, Affinity Purified
MBS3902353-01 0.002 mg

Rabbit anti-ZEB1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ZEB1 Antibody, Affinity Purified
MBS3902353-02 0.02 mg

Rabbit anti-ZEB1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ZEB1 Antibody, Affinity Purified
MBS3902353-03 5x 0.002 mg

Rabbit anti-ZEB1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ZEB1 Antibody, Affinity Purified
MBS3902353-04 5x 0.02 mg

Rabbit anti-ZEB1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Recombinant Human NARS Protein, His, E.coli-1mg
QP12794-HIS-1mg 1mg

Recombinant Human NARS Protein, His, E.coli-1mg

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Rat CD44H Antibody[OX-49]
E-AB-F1225J-01 50 Tests

PerCP/Cyanine5.5 Anti-Rat CD44H Antibody[OX-49]

Sign In for Pricing
View Details