CYB561D2 Peptide - N-terminal region
CYB561D2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CYB561D2,101F6, LUCA12.2
UniProt
O14569
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CYB561D2 Rabbit Polyclonal Antibody (orb331371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005264889
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALSAETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLFSWHPVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![3,3'-[Oxybis(3,1-propanediyloxy)]bis[1-propanol]](https://cdn.genprice.uk/products/572/2758869375204/imageurl/trc-o870290-50mg.webp)
TRC-O870290-50MG 50 mg
3,3'-[Oxybis(3,1-propanediyloxy)]bis[1-propanol]
Sign In for Pricing
View Details 
BNC060315-500 1x 500 µL
Heparan Sulphate Proteoglycan (A7L6), CF405L conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUM1824-50 1x 50 µL
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), 1mg/mL
Sign In for Pricing
View Details