Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYB561D2 Peptide - N-terminal region

CYB561D2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CYB561D2,101F6, LUCA12.2

UniProt

O14569

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYB561D2 Rabbit Polyclonal Antibody (orb331371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005264889

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALSAETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLFSWHPVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G protein alpha S (GNAS) (NM_000516) Human Recombinant Protein
TP314197M 100 µg

G protein alpha S (GNAS) (NM_000516) Human Recombinant Protein

Sign In for Pricing
View Details
PCR Plates
P9601-N 50 Units/Pack

PCR Plates

Sign In for Pricing
View Details
Recombinant Transferrin Receptor/TFRC/CD71 Monoclonal Antibody
AN300360P-01 20 µL

Recombinant Transferrin Receptor/TFRC/CD71 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Transferrin Receptor/TFRC/CD71 Monoclonal Antibody
AN300360P-02 100 µL

Recombinant Transferrin Receptor/TFRC/CD71 Monoclonal Antibody

Sign In for Pricing
View Details
IRF7 Rabbit Polyclonal Antibody
AP07320PU-N 50 µg

IRF7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS502523 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details