Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QL3 Peptide - middle region

C1QL3 Peptide - middle region

Product Specifications

Product Name Alternative

C1QL3, CTRP13

UniProt

Q5VWW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1QL3 Rabbit Polyclonal Antibody (orb586935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010908

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ebola Virus (Ebolavirus, EHF, EV, EVD, EBOV, Ebola Hemorrhagic Fever, Ebola Virus Zaire) (MaxLight 650)
MBS6265019-01 0.1 mL

Ebola Virus (Ebolavirus, EHF, EV, EVD, EBOV, Ebola Hemorrhagic Fever, Ebola Virus Zaire) (MaxLight 650)

Sign In for Pricing
View Details
Ebola Virus (Ebolavirus, EHF, EV, EVD, EBOV, Ebola Hemorrhagic Fever, Ebola Virus Zaire) (MaxLight 650)
MBS6265019-02 5x 0.1 mL

Ebola Virus (Ebolavirus, EHF, EV, EVD, EBOV, Ebola Hemorrhagic Fever, Ebola Virus Zaire) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Polyclonal Thimet Oligopeptidase/THOP1 Antibody [Alexa Fluor 594]
NBP2-98355AF594 0.1 mL

Rabbit Polyclonal Thimet Oligopeptidase/THOP1 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Rabbit Anti-FKBP1A monoclonal antibody, clone KN22-10
CABT-L928 100 ul

Rabbit Anti-FKBP1A monoclonal antibody, clone KN22-10

Sign In for Pricing
View Details
FITC Anti-Mouse Perforin Antibody
RD30538F-01 50 Tests

FITC Anti-Mouse Perforin Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse Perforin Antibody
RD30538F-02 100 Tests

FITC Anti-Mouse Perforin Antibody

Sign In for Pricing
View Details