Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMC10 Peptide - C-terminal region

EMC10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EMC10, C19orf63, HSM1, INM02, UNQ764/PRO1556

UniProt

Q5UCC4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EMC10 Rabbit Polyclonal Antibody (orb326740) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_996261

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWMYIIPVVLFLMM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NHE3/SLC9A3 Antibody [Alexa Fluor 532]
NBP3-00589AF532 0.1 mL

Rabbit Polyclonal NHE3/SLC9A3 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Horse E2F Transcription Factor 3 ELISA Kit
MBS090363-01 48 Well

Horse E2F Transcription Factor 3 ELISA Kit

Sign In for Pricing
View Details
Horse E2F Transcription Factor 3 ELISA Kit
MBS090363-02 96 Well

Horse E2F Transcription Factor 3 ELISA Kit

Sign In for Pricing
View Details
Horse E2F Transcription Factor 3 ELISA Kit
MBS090363-03 5x 96 Well

Horse E2F Transcription Factor 3 ELISA Kit

Sign In for Pricing
View Details
Horse E2F Transcription Factor 3 ELISA Kit
MBS090363-04 10x 96 Well

Horse E2F Transcription Factor 3 ELISA Kit

Sign In for Pricing
View Details
Recombinant Vicugna pacos IL21 Protein, N-His
orb3151029-01 50 µg

Recombinant Vicugna pacos IL21 Protein, N-His

Sign In for Pricing
View Details