CEACAM20 Peptide - C-terminal region
CEACAM20 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CEACAM20, UNQ9366/PRO34155
UniProt
Q6UY09
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CEACAM20 Rabbit Polyclonal Antibody (orb326749) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001096070
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VIAVASELGYFLCIRNARRPSRKTTEDPSHETSQPIPKEEHPTEPSSESL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1018-500 1x 500 µL
CD117 (Cocktail), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 