CWF19L2 Peptide - N-terminal region
CWF19L2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CWF19L2
UniProt
Q2TBE0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CWF19L2 Rabbit Polyclonal Antibody (orb586972) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689647
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PPEDCSVSSITKVSVVEDGGLSWLRKSYLRMKEQAEKQSRNFEDIVAERY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP07398PU-N 50 µg
P Glycoprotein (ABCB1) (262-277) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details ![Glucocorticoid Receptor (NR3C1) Mouse Monoclonal Antibody [Clone ID: 6E6]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbe4a/imageurl/am06570su-n.webp)
AM06570SU-N 100 µL
Glucocorticoid Receptor (NR3C1) Mouse Monoclonal Antibody [Clone ID: 6E6]
Sign In for Pricing
View Details ![Rabbit Monoclonal Antibody [Clone ID: P38G1]](https://cdn.genprice.uk/products/937/68dd1b5f061270361ea11b0f/imageurl/ta399858.webp)
BNC470280-100 1x 100 µL
Glycophorin A / CD235a (GYPA/280), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details