Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND3 Peptide - C-terminal region

DENND3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DENND3, KIAA0870

UniProt

A2RUS2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DENND3 Rabbit Polyclonal Antibody (orb586981) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055772

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INCMIRVKKQVWVGSRGLGQGTPKGKIYVIDAERKTVEKELVAHMDTVRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD19 Antibody[SJ25C1]
AN003340P-01 25 µg

Purified Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
Purified Anti-Human CD19 Antibody[SJ25C1]
AN003340P-02 100 µg

Purified Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (F4), Biotin conjugate, 0.1mg/mL
BNCB2180-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (F4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB524785 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
Tissue Total RNA, Duodenum
CR561215 5 µg

Tissue Total RNA, Duodenum

Sign In for Pricing
View Details
Cleaved LC3A Antibody (ATG8a/APG8a)
F46138-0.4ML 0.4 mL

Cleaved LC3A Antibody (ATG8a/APG8a)

Sign In for Pricing
View Details