Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND3 Peptide - C-terminal region

DENND3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DENND3, KIAA0870

UniProt

A2RUS2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DENND3 Rabbit Polyclonal Antibody (orb586981) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055772

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INCMIRVKKQVWVGSRGLGQGTPKGKIYVIDAERKTVEKELVAHMDTVRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF568 conjugate, 0.1mg/mL
BNC682350-100 1x 100 µL

GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WDR46 (NM_001164267) Human Over-expression Lysate
LC431478 20 µg

WDR46 (NM_001164267) Human Over-expression Lysate

Sign In for Pricing
View Details
Ethylmedetomidine Hydrochloride
TRC-E922010-10MG 10 mg

Ethylmedetomidine Hydrochloride

Sign In for Pricing
View Details
Rpl21 Mouse Gene Knockout Kit (CRISPR)
KN515024 1 Kit

Rpl21 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IMP3 (IGF2BP3) Rabbit Polyclonal Antibody
TA377380 100 µL

IMP3 (IGF2BP3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DMDM Hydantoin
TRC-P688135-5G 5 g

DMDM Hydantoin

Sign In for Pricing
View Details