Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAXC Peptide - C-terminal region

FAXC Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAXC, C6orf168

UniProt

Q5TGI0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAXC Rabbit Polyclonal Antibody (orb326832) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115900

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVFGHLAQAMWTLPGTRPERLIKGELINLAMYCERIRRKFWPEWHHDDDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF585B (NM_152279) Human Over-expression Lysate
LH14434V 100 µg

ZNF585B (NM_152279) Human Over-expression Lysate

Sign In for Pricing
View Details
UGT2B15 Blocking Peptide
33R-4025 100 ug

UGT2B15 Blocking Peptide

Sign In for Pricing
View Details
EDAR; DL Protein (C-Fc , Mouse)
P514855 100 µg

EDAR; DL Protein (C-Fc , Mouse)

Sign In for Pricing
View Details
Zfp292 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV639886 1.0 µg DNA

Zfp292 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Prop-2-en-1-yl (2S) -2-amino-3-methylbutanoate hydrochloride
TPD50129-01 50 mg

Prop-2-en-1-yl (2S) -2-amino-3-methylbutanoate hydrochloride

Sign In for Pricing
View Details
Prop-2-en-1-yl (2S) -2-amino-3-methylbutanoate hydrochloride
TPD50129-02 0.5 g

Prop-2-en-1-yl (2S) -2-amino-3-methylbutanoate hydrochloride

Sign In for Pricing
View Details