Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT19 Peptide - C-terminal region

NUDT19 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NUDT19

UniProt

A8MXV4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT19 Rabbit Polyclonal Antibody (orb587308) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099040

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLERWLPIILLTADGMVHLLPGDELYLEDSDFLENLMSTEKKTEEIMKEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIP Recombinant Rabbit monoclonal Antibody
HA750858 100 µL

AIP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF660R Conjugate, 0.1 mg/mL
BNC611331-250 1x 250 µL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF660R Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
SLC66A2 (Center) Rabbit Polyclonal Antibody
AP53427PU-N 400 µL

SLC66A2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS629694 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
CIRBP Human Gene Knockout Kit (CRISPR)
KN401639 1 Kit

CIRBP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDGF AA (PDGFA) (NM_033023) Human Recombinant Protein
TP314164L 1 mg

PDGF AA (PDGFA) (NM_033023) Human Recombinant Protein

Sign In for Pricing
View Details