Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC58 Peptide - C-terminal region

LRRC58 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LRRC58

UniProt

Q96CX6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001093148

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQSESDSEDEASVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme K (GZMK) (NM_002104) Human Over-expression Lysate
LC419525 20 µg

Granzyme K (GZMK) (NM_002104) Human Over-expression Lysate

Sign In for Pricing
View Details
EPDR1 Polyclonal Antibody
E-AB-11192-01 20 µL

EPDR1 Polyclonal Antibody

Sign In for Pricing
View Details
EPDR1 Polyclonal Antibody
E-AB-11192-02 60 µL

EPDR1 Polyclonal Antibody

Sign In for Pricing
View Details
EPDR1 Polyclonal Antibody
E-AB-11192-03 120 µL

EPDR1 Polyclonal Antibody

Sign In for Pricing
View Details
EPDR1 Polyclonal Antibody
E-AB-11192-04 200 µL

EPDR1 Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin A1 (XLA1-3), CF594 conjugate, 0.1mg/mL
BNC943049-100 1x 100 µL

Cyclin A1 (XLA1-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details