Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC58 Peptide - C-terminal region

LRRC58 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LRRC58

UniProt

Q96CX6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001093148

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQSESDSEDEASVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF2 Rabbit Polyclonal Antibody
TA373025 100 µL

FGF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OLR1 Antibody
KC-2969-01 50 μL

OLR1 Antibody

Sign In for Pricing
View Details
OLR1 Antibody
KC-2969-02 100 µL

OLR1 Antibody

Sign In for Pricing
View Details
OLR1 Antibody
KC-2969-03 1 mL

OLR1 Antibody

Sign In for Pricing
View Details
YPEL2 (NM_001005404) Human Over-expression Lysate
LY423712 100 µg

YPEL2 (NM_001005404) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
TA396898S 25 µL

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details