Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR14I1 Peptide - C-terminal region

OR14I1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR14I1, OR5BU1, OR5BU1P

UniProt

A6ND48

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR14I1 Rabbit Polyclonal Antibody (orb327068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005273189

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGCFILMMISYFQIFSTVLRIPSGQSRAKAFSTCSPQLIVIMLFLTTGLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44v4 (Marker of Tumor Metastasis), CF488A conjugate, 0.1mg/mL
BNC881751-100 1x 100 µL

CD44v4 (Marker of Tumor Metastasis), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-(5-Isoquinolinesulfonyl)piperazine Hydrochloride
TRC-I891000-25MG 25 mg

1-(5-Isoquinolinesulfonyl)piperazine Hydrochloride

Sign In for Pricing
View Details
Tissue Total RNA, Pancreas
CR561222 5 µg

Tissue Total RNA, Pancreas

Sign In for Pricing
View Details
IFNE1 (IFNE) Human Gene Knockout Kit (CRISPR)
KN222153 1 Kit

IFNE1 (IFNE) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thyroid Hormone Receptor alpha (THRA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A2]
TA805187BM 100 µL

Thyroid Hormone Receptor alpha (THRA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A2]

Sign In for Pricing
View Details
MART-1 / Melan-A (MLANA/788), CF740 conjugate, 0.1mg/mL
BNC740788-100 1x 100 µL

MART-1 / Melan-A (MLANA/788), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details