FAM189A1 Peptide - middle region
FAM189A1 Peptide - middle region
Product Specifications
Product Name Alternative
FAM189A1, KIAA0574, TMEM228
UniProt
O60320
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM189A1 Rabbit Polyclonal Antibody (orb587833) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AQLSPAGDPDTWKTDQRPTPEPFPATSKERPRSLVDSKAYADARVLVAKF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470050-100 1x 100 µL
IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680375-100 1x 100 µL
P40 (Rabbit PAb), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details