Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DND1 Peptide - N-terminal region

DND1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DND1, RBMS4

UniProt

Q8IYX4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_919225

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MQSKRDCELWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine HCV IgD ELISA Kit
EPH0010 96 Tests

Porcine HCV IgD ELISA Kit

Sign In for Pricing
View Details
Tsg 101 Polyclonal Antibody
RA20614-01 50 µL

Tsg 101 Polyclonal Antibody

Sign In for Pricing
View Details
Tsg 101 Polyclonal Antibody
RA20614-02 100 µL

Tsg 101 Polyclonal Antibody

Sign In for Pricing
View Details
SLC25A30 (NM_001010875) Human Untagged Clone
SC301498 10 µg

SLC25A30 (NM_001010875) Human Untagged Clone

Sign In for Pricing
View Details
SIRPA (BIT, MFR, MYD1, PTPNS1, SHPS1, SIRP, Tyrosine-protein Phosphatase Non-receptor Type Substrate 1, Brain Ig-like Molecule with Tyrosine-based Activation Motifs, CD172 Antigen-like Family Member A, Inhibitory Receptor SHPS-1, Macrophage Fusion Recepto
MBS6224112-01 0.1 mL

SIRPA (BIT, MFR, MYD1, PTPNS1, SHPS1, SIRP, Tyrosine-protein Phosphatase Non-receptor Type Substrate 1, Brain Ig-like Molecule with Tyrosine-based Activation Motifs, CD172 Antigen-like Family Member A, Inhibitory Receptor SHPS-1, Macrophage Fusion Recepto

Sign In for Pricing
View Details
SIRPA (BIT, MFR, MYD1, PTPNS1, SHPS1, SIRP, Tyrosine-protein Phosphatase Non-receptor Type Substrate 1, Brain Ig-like Molecule with Tyrosine-based Activation Motifs, CD172 Antigen-like Family Member A, Inhibitory Receptor SHPS-1, Macrophage Fusion Recepto
MBS6224112-02 5x 0.1 mL

SIRPA (BIT, MFR, MYD1, PTPNS1, SHPS1, SIRP, Tyrosine-protein Phosphatase Non-receptor Type Substrate 1, Brain Ig-like Molecule with Tyrosine-based Activation Motifs, CD172 Antigen-like Family Member A, Inhibitory Receptor SHPS-1, Macrophage Fusion Recepto

Sign In for Pricing
View Details