Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DND1 Peptide - N-terminal region

DND1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DND1, RBMS4

UniProt

Q8IYX4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_919225

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MQSKRDCELWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DLL4 Protein
orb425132-01 2 µg

Mouse DLL4 Protein

Sign In for Pricing
View Details
Mouse DLL4 Protein
orb425132-02 10 µg

Mouse DLL4 Protein

Sign In for Pricing
View Details
Mouse DLL4 Protein
orb425132-03 1 mg

Mouse DLL4 Protein

Sign In for Pricing
View Details
Human NKG2D ligand 2 ELISA Kit
MBS9428273-01 96 Tests

Human NKG2D ligand 2 ELISA Kit

Sign In for Pricing
View Details
Human NKG2D ligand 2 ELISA Kit
MBS9428273-02 5x 96 Tests

Human NKG2D ligand 2 ELISA Kit

Sign In for Pricing
View Details
(R) -2- ((tert-Butoxycarbonyl) amino) pentanoic acid 10000mg
A23708-10000 10000 mg

(R) -2- ((tert-Butoxycarbonyl) amino) pentanoic acid 10000mg

Sign In for Pricing
View Details