Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRSK2 Peptide - middle region

BRSK2 Peptide - middle region

Product Specifications

Product Name Alternative

BRSK2, C11orf7, PEN11B, SADA, STK29, HUSSY-12

UniProt

Q8IWQ3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRSK2 Rabbit Polyclonal Antibody (orb588078) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDPPRKRVDSPMLNRHG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDDC3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
23140156 3x 1.0 µg DNA

HDDC3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Adh4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3716808 1.0 µg DNA

Adh4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
NOX4 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4) Porcine ELISA Kit
F4292 96 Tests

NOX4 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4) Porcine ELISA Kit

Sign In for Pricing
View Details
(Mouse) Med15 Antibody (C-term)
orb1926469-01 50 µL

(Mouse) Med15 Antibody (C-term)

Sign In for Pricing
View Details
(Mouse) Med15 Antibody (C-term)
orb1926469-02 100 µL

(Mouse) Med15 Antibody (C-term)

Sign In for Pricing
View Details
SCIN Recombinant Antibody, HRP Conjugated
bsm-62533R-HRP 100 µL

SCIN Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details