Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRSK2 Peptide - middle region

BRSK2 Peptide - middle region

Product Specifications

Product Name Alternative

BRSK2, C11orf7, PEN11B, SADA, STK29, HUSSY-12

UniProt

Q8IWQ3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRSK2 Rabbit Polyclonal Antibody (orb588078) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDPPRKRVDSPMLNRHG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Ethyl-2-methylpyridine-3-carboxylic acid
XZB34849-01 50 mg

6-Ethyl-2-methylpyridine-3-carboxylic acid

Sign In for Pricing
View Details
6-Ethyl-2-methylpyridine-3-carboxylic acid
XZB34849-02 0.5 g

6-Ethyl-2-methylpyridine-3-carboxylic acid

Sign In for Pricing
View Details
HEATR5A Human siRNA Oligo Duplex (Locus ID 25938)
SR308610 1 Kit

HEATR5A Human siRNA Oligo Duplex (Locus ID 25938)

Sign In for Pricing
View Details
Rabbit Anti-NFX1 Polyclonal Antibody
PAV2515 100 μL

Rabbit Anti-NFX1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Shewanella sp. ATP synthase subunit a (atpB)
orb2911346-01 20 µg

Recombinant Shewanella sp. ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Shewanella sp. ATP synthase subunit a (atpB)
orb2911346-02 100 µg

Recombinant Shewanella sp. ATP synthase subunit a (atpB)

Sign In for Pricing
View Details