Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLCN6 Peptide - C-terminal region

CLCN6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLCN6, KIAA0046

UniProt

P51797

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLCN6 Rabbit Polyclonal Antibody (orb588084) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001277

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYTPYPNLYPDQSPSEDWTMEERFRPLTFHGLILRSQLVTLLVRGVCYSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Trim30d shRNA (UAS) - Lentiviral mouseTrim30d shRNA (UAS, GFP) (25)
GTR15198908 1 Vial

Lentiviral mouse Trim30d shRNA (UAS) - Lentiviral mouseTrim30d shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
MGST1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
28557064 1.0 µg DNA

MGST1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RNF141 Recombinant Protein Antigen
NBP1-80603PEP 0.1 mL

RNF141 Recombinant Protein Antigen

Sign In for Pricing
View Details
CD177 (C-1) AC
sc-374291 AC 500 µg/mL - 25% ag

CD177 (C-1) AC

Sign In for Pricing
View Details
Tpra1 Mouse Gene Knockout Kit (CRISPR)
KN518103 1 Kit

Tpra1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Emc1 (NM_001108690) Rat Untagged Clone
RN202945 10 µg

Emc1 (NM_001108690) Rat Untagged Clone

Sign In for Pricing
View Details