Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLCN6 Peptide - C-terminal region

CLCN6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLCN6, KIAA0046

UniProt

P51797

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLCN6 Rabbit Polyclonal Antibody (orb588084) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001277

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYTPYPNLYPDQSPSEDWTMEERFRPLTFHGLILRSQLVTLLVRGVCYSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAP-2, human recombinant
4381-1000 1 mg

NAP-2, human recombinant

Sign In for Pricing
View Details
SERPINA6 (Serpin Peptidase Inhibitor, Clade A (alpha-1 Antiproteinase, Antitrypsin), Member 6, CBG) (APC)
251519-APC 100 µL

SERPINA6 (Serpin Peptidase Inhibitor, Clade A (alpha-1 Antiproteinase, Antitrypsin), Member 6, CBG) (APC)

Sign In for Pricing
View Details
PLEKHA1 Antibody (Center) Blocking Peptide
MBS9223258-01 0.5 mg

PLEKHA1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
PLEKHA1 Antibody (Center) Blocking Peptide
MBS9223258-02 5x 0.5 mg

PLEKHA1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Cytokeratin 4 Rabbit mAb
E2R381346 100 µL

Cytokeratin 4 Rabbit mAb

Sign In for Pricing
View Details
POLR3E Antibody
A67800-100UG 100 µg

POLR3E Antibody

Sign In for Pricing
View Details