Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC7 Peptide - middle region

EXOC7 Peptide - middle region

Product Specifications

Product Name Alternative

EXOC7, EXO70, KIAA1067

UniProt

Q9UPT5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC7 Rabbit Polyclonal Antibody (orb331439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056034

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLITSMETIGAKALEDFADNIKNDPDKEYNMPKDGTVHELTSNAILFLQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC029877 ORF Vector (Human) (pORF)
ORF000931 1.0 µg DNA

BC029877 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans Bifunctional protein HldE (hldE)
MBS1411118-01 0.02 mg (E-Coli)

Recombinant Shewanella denitrificans Bifunctional protein HldE (hldE)

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans Bifunctional protein HldE (hldE)
MBS1411118-02 0.02 mg (Yeast)

Recombinant Shewanella denitrificans Bifunctional protein HldE (hldE)

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans Bifunctional protein HldE (hldE)
MBS1411118-03 0.1 mg (E-Coli)

Recombinant Shewanella denitrificans Bifunctional protein HldE (hldE)

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans Bifunctional protein HldE (hldE)
MBS1411118-04 0.1 mg (Yeast)

Recombinant Shewanella denitrificans Bifunctional protein HldE (hldE)

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans Bifunctional protein HldE (hldE)
MBS1411118-05 0.02 mg (Baculovirus)

Recombinant Shewanella denitrificans Bifunctional protein HldE (hldE)

Sign In for Pricing
View Details