EXOC7 Peptide - middle region
EXOC7 Peptide - middle region
Product Specifications
Product Name Alternative
EXOC7, EXO70, KIAA1067
UniProt
Q9UPT5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EXOC7 Rabbit Polyclonal Antibody (orb331439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056034
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GLITSMETIGAKALEDFADNIKNDPDKEYNMPKDGTVHELTSNAILFLQQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8424924-01 0.12 mL
Rabbit Anti Human UBE3A Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
Sign In for Pricing
View Details MBS8424924-02 0.2 mL
Rabbit Anti Human UBE3A Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
Sign In for Pricing
View Details MBS8424924-03 5x 0.2 mL
Rabbit Anti Human UBE3A Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
Sign In for Pricing
View Details 