Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNB1 Peptide - C-terminal region

KCNB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KCNB1

UniProt

Q14721

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNB1 Rabbit Polyclonal Antibody (orb575387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004966

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAKTQSQPILNTKESAAQSKPKEELEMESIPSPVAPLPTRTEGVIDMRSM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tanezumab ELISA Kit
orb2975830 96 Tests

Tanezumab ELISA Kit

Sign In for Pricing
View Details
KLHDC9 Antibody Blocking Peptide
orb1501271 500 µg

KLHDC9 Antibody Blocking Peptide

Sign In for Pricing
View Details
Marek Disease (Gallid Herpes virus 2, Gallid Herpes virus Type 2, GaHV-2, Marek's Disease Herpes virus 2, Marek's Disease Virus Type 2, MDV) (MaxLight 550) discontinued
M2400-01G-ML550 100 µL

Marek Disease (Gallid Herpes virus 2, Gallid Herpes virus Type 2, GaHV-2, Marek's Disease Herpes virus 2, Marek's Disease Virus Type 2, MDV) (MaxLight 550) discontinued

Sign In for Pricing
View Details
DAO, ID (DAO, DAMOX, D-amino-acid oxidase) (APC)
MBS6290772-01 0.2 mL

DAO, ID (DAO, DAMOX, D-amino-acid oxidase) (APC)

Sign In for Pricing
View Details
DAO, ID (DAO, DAMOX, D-amino-acid oxidase) (APC)
MBS6290772-02 5x 0.2 mL

DAO, ID (DAO, DAMOX, D-amino-acid oxidase) (APC)

Sign In for Pricing
View Details
Human 26S proteasome non ATPase regulatory subunit 13 (PSMD13) ELISA Kit
MBS7250654-01 48 Well

Human 26S proteasome non ATPase regulatory subunit 13 (PSMD13) ELISA Kit

Sign In for Pricing
View Details