Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNB1 Peptide - C-terminal region

KCNB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KCNB1

UniProt

Q14721

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNB1 Rabbit Polyclonal Antibody (orb575387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004966

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAKTQSQPILNTKESAAQSKPKEELEMESIPSPVAPLPTRTEGVIDMRSM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Cytokeratin 8 Recombinant Monoclonal Antibody [BLR299M)
A700-299 100 µL (50+ Tests)

Rabbit anti-Cytokeratin 8 Recombinant Monoclonal Antibody [BLR299M)

Sign In for Pricing
View Details
Gm10375 3'UTR GFP Stable Cell Line
TU157260 1.0 mL

Gm10375 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Dkk1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
18260114 3x 1.0 µg

Dkk1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ORC3L (Origin Recognition Complex Protein subunit 3-Like) discontinued
O7050-10 100 µg

ORC3L (Origin Recognition Complex Protein subunit 3-Like) discontinued

Sign In for Pricing
View Details
NDUFS5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
31665061 1.0 µg DNA

NDUFS5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
4-Bromobenzo[d]isoxazol-3-amine
OR91204-01 1 g

4-Bromobenzo[d]isoxazol-3-amine

Sign In for Pricing
View Details