Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD20 Peptide - C-terminal region

KCTD20 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KCTD20, C6orf69

UniProt

Q7Z5Y7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCTD20 Rabbit Polyclonal Antibody (orb575516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005248997

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSVDWDEDHPPPMGEEYSQILYSSKLYRFFKYIENRDVAKTVLKERGLKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRGRF antibody
70R-30985 0.1 mg

MRGRF antibody

Sign In for Pricing
View Details
FBS Südamerika eat-inactivated - 30minbat 56°C
FCS.HI.0100 100 mL

FBS Südamerika eat-inactivated - 30minbat 56°C

Sign In for Pricing
View Details
Monoclonal CD14 Antibody, Clone: 4B4F12
AMM02965G 0.1ml

Monoclonal CD14 Antibody, Clone: 4B4F12

Sign In for Pricing
View Details
Guinea Pig Arf GAP with GTPase, ANK repeat and PH domain containing protein 5 (AGAP5) ELISA Kit
GTR10335986 96 Well

Guinea Pig Arf GAP with GTPase, ANK repeat and PH domain containing protein 5 (AGAP5) ELISA Kit

Sign In for Pricing
View Details
Anti-Marcksl1 antibody
PAab05008 100 µg

Anti-Marcksl1 antibody

Sign In for Pricing
View Details
Fmoc-2-aminobutyric acid
OR452095-01 1 g

Fmoc-2-aminobutyric acid

Sign In for Pricing
View Details