SLC39A10 Peptide - N-terminal region
SLC39A10 Peptide - N-terminal region
Product Specifications
Product Name Alternative
SLC39A10, KIAA1265, ZIP10
UniProt
Q9ULF5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC39A10 Rabbit Polyclonal Antibody (orb579016) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065075
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HDHVSHLDILAVQEGKHFHSHNHQHSHNHLNSENQTVTSVSTKRNHKCDP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740460-500 1x 500 µL
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880800-500 1x 500 µL
Cytokeratin 19 (KRT19/800), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470893-100 1x 100 µL
Myosin, Smooth Muscle Heavy Chain (SMMS-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details