Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM220 Peptide - middle region

TMEM220 Peptide - middle region

Product Specifications

Product Name Alternative

TMEM220

UniProt

Q6QAJ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM220 Rabbit Polyclonal Antibody (orb325153) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LASYLLHRTQQNILHEEEGRELSGLVIITAWIILCHSSSKNPVGGRIQLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLHL7 activation kit by CRISPRa
GA111082 1 Kit

Human KLHL7 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Protein Lysate, Esophagus
CP565449 150 µg

Tissue Protein Lysate, Esophagus

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal), CF740 conjugate, 0.1mg/mL
BNC741728-100 1x 100 µL

Parathyroid Hormone (PTH) (N-Terminal), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UBE4B Polyclonal Antibody
E-AB-53570-01 20 µL

UBE4B Polyclonal Antibody

Sign In for Pricing
View Details
UBE4B Polyclonal Antibody
E-AB-53570-02 60 µL

UBE4B Polyclonal Antibody

Sign In for Pricing
View Details
UBE4B Polyclonal Antibody
E-AB-53570-03 120 µL

UBE4B Polyclonal Antibody

Sign In for Pricing
View Details