Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM220 Peptide - middle region

TMEM220 Peptide - middle region

Product Specifications

Product Name Alternative

TMEM220

UniProt

Q6QAJ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM220 Rabbit Polyclonal Antibody (orb325153) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LASYLLHRTQQNILHEEEGRELSGLVIITAWIILCHSSSKNPVGGRIQLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PDK4 activation kit by CRISPRa
GA103463 1 Kit

Human PDK4 activation kit by CRISPRa

Sign In for Pricing
View Details
CYYR1 (NM_052954) Human Over-expression Lysate
LY403280 100 µg

CYYR1 (NM_052954) Human Over-expression Lysate

Sign In for Pricing
View Details
Arg8-Vasopressin (AVP) ELISA Kit
K049-H5 5 Plates

Arg8-Vasopressin (AVP) ELISA Kit

Sign In for Pricing
View Details
Recombinant CBS Antibody
RC-15077-01 50 μL

Recombinant CBS Antibody

Sign In for Pricing
View Details
Recombinant CBS Antibody
RC-15077-02 100 µL

Recombinant CBS Antibody

Sign In for Pricing
View Details
Recombinant CBS Antibody
RC-15077-03 1 mL

Recombinant CBS Antibody

Sign In for Pricing
View Details