Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT61B Peptide - C-terminal region

TRMT61B Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRMT61B

UniProt

Q9BVS5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRMT61B Rabbit Polyclonal Antibody (orb580532) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060380

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKINTDVQLDSQEKIGVKGELFQEDDHEESHSDFPYGSFPYVARPVHWQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Exoc1 shRNA (UAS) - Lentiviral mouse Exoc1 shRNA (UAS, RFP) plasmid
GTR15272665 1 Vial

Lentiviral mouse Exoc1 shRNA (UAS) - Lentiviral mouse Exoc1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Monoclonal Antibody to Galectin-1 (Clone: ABM5B54)
MBS669038-01 0.025 mg

Monoclonal Antibody to Galectin-1 (Clone: ABM5B54)

Sign In for Pricing
View Details
Monoclonal Antibody to Galectin-1 (Clone: ABM5B54)
MBS669038-02 0.1 mg

Monoclonal Antibody to Galectin-1 (Clone: ABM5B54)

Sign In for Pricing
View Details
Monoclonal Antibody to Galectin-1 (Clone: ABM5B54)
MBS669038-03 5x 0.1 mg

Monoclonal Antibody to Galectin-1 (Clone: ABM5B54)

Sign In for Pricing
View Details
Pig alpha-amylase (AMS) ELISA Kit
orb3012130-01 48 Tests

Pig alpha-amylase (AMS) ELISA Kit

Sign In for Pricing
View Details
Pig alpha-amylase (AMS) ELISA Kit
orb3012130-02 96 Tests

Pig alpha-amylase (AMS) ELISA Kit

Sign In for Pricing
View Details