Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT61B Peptide - C-terminal region

TRMT61B Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRMT61B

UniProt

Q9BVS5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRMT61B Rabbit Polyclonal Antibody (orb580532) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060380

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKINTDVQLDSQEKIGVKGELFQEDDHEESHSDFPYGSFPYVARPVHWQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHOX2 sgRNA CRISPR Lentivector set (Human)
K2145601 3x 1.0 µg

SHOX2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Hamster Protein Kinase B ELISA Kit
MBS025854-01 48 Well

Hamster Protein Kinase B ELISA Kit

Sign In for Pricing
View Details
Hamster Protein Kinase B ELISA Kit
MBS025854-02 96 Well

Hamster Protein Kinase B ELISA Kit

Sign In for Pricing
View Details
Hamster Protein Kinase B ELISA Kit
MBS025854-03 5x 96 Well

Hamster Protein Kinase B ELISA Kit

Sign In for Pricing
View Details
Hamster Protein Kinase B ELISA Kit
MBS025854-04 10x 96 Well

Hamster Protein Kinase B ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-RAP2B Antibody
DL94508A-01 50 µL

Rabbit anti-RAP2B Antibody

Sign In for Pricing
View Details