METTL22 Peptide - C-terminal region
METTL22 Peptide - C-terminal region
Product Specifications
Product Name Alternative
METTL22, C16orf68, LP8272
UniProt
Q9BUU2
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with METTL22 Rabbit Polyclonal Antibody (orb580566) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FTLRHLDVTCEAYDHFRSCLHALEQLADGKLRFVVEPVEASFPQLLVYER
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401045-100 1x 100 µL
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940460-100 1x 100 µL
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details