DNAJC10 Peptide - N-terminal region
DNAJC10 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DNAJC10, ERDJ5, UNQ495/PRO1012
UniProt
Q8IXB1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DNAJC10 Rabbit Polyclonal Antibody (orb580723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DLRKKYDKYGEKGLEDNQGGQYESWNYYRYDFGIYDDDPEIITLERREFD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400146-100 1x 100 µL
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942224-100 1x 100 µL
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042603-500 1x 500 µL
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2603), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 