Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSSC4 Peptide - N-terminal region

TSSC4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TSSC4

UniProt

Q9Y5U2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSSC4 Rabbit Polyclonal Antibody (orb325716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLSLPGGAEVEALSPMGLPGEEDSGPDEPPSPPSGLLPATVQPFHLRGMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPV3 Protein Lysate (Human) with C-Ha Tag
48532031 100 µg

TRPV3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
(ACTG) 6 MB-Fl; 25 ug
45-4340-06 25 µg

(ACTG) 6 MB-Fl; 25 ug

Sign In for Pricing
View Details
Goat Matrix Metalloproteinase 7 ELISA Kit
MBS037989 Inquire

Goat Matrix Metalloproteinase 7 ELISA Kit

Sign In for Pricing
View Details
5-Bromopentanoic Acid Ethyl Ester
TRC-B686125-1G 1 g

5-Bromopentanoic Acid Ethyl Ester

Sign In for Pricing
View Details
Mouse Monoclonal MOBKL2B Antibody (OTI6C6) [Janelia Fluor 646]
NBP2-72748JF646 0.1 mL

Mouse Monoclonal MOBKL2B Antibody (OTI6C6) [Janelia Fluor 646]

Sign In for Pricing
View Details
Alox12b (NM_009659) Mouse Tagged ORF Clone Lentiviral Particle
MR223970L3V 200 µL

Alox12b (NM_009659) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details