Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSSC4 Peptide - N-terminal region

TSSC4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TSSC4

UniProt

Q9Y5U2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSSC4 Rabbit Polyclonal Antibody (orb325716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLSLPGGAEVEALSPMGLPGEEDSGPDEPPSPPSGLLPATVQPFHLRGMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX1 Antibody
A53696-100UL 100 µL

SSX1 Antibody

Sign In for Pricing
View Details
TMEM100 Polyclonal Antibody, HRP Conjugated
A61357-050 50 µL

TMEM100 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Chac2 (NM_001025016) Rat Untagged Clone
RN211063 10 µg

Chac2 (NM_001025016) Rat Untagged Clone

Sign In for Pricing
View Details
COQ10B HDR Plasmid (m)
sc-426798-HDR 20 µg

COQ10B HDR Plasmid (m)

Sign In for Pricing
View Details
Human Hepatitis B virus total antibody Elisa Kit
EK714977 96 Well

Human Hepatitis B virus total antibody Elisa Kit

Sign In for Pricing
View Details
SRD5A3, CT (SRD5A3, SRD5A2L, Probable polyprenol reductase, 3-oxo-5-alpha-steroid 4-dehydrogenase 3, Steroid 5-alpha-reductase 2-like, Steroid 5-alpha-reductase 3) (MaxLight 750) discontinued
042297-ML750 100 µL

SRD5A3, CT (SRD5A3, SRD5A2L, Probable polyprenol reductase, 3-oxo-5-alpha-steroid 4-dehydrogenase 3, Steroid 5-alpha-reductase 2-like, Steroid 5-alpha-reductase 3) (MaxLight 750) discontinued

Sign In for Pricing
View Details