Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOB1 Peptide - N-terminal region

TOB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TOB1, TOB, TROB1

UniProt

P50616

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOB1 Rabbit Polyclonal Antibody (orb581572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005740

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GDF2 sgRNA gene knockout kit - Lentiviral human GDF2 sgRNA gene knockout kit (100)
GTR15386647 1 Vial

Lentiviral human GDF2 sgRNA gene knockout kit - Lentiviral human GDF2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Clrn3 ORF Vector (Mouse) (pORF)
ORF041604 1.0 µg DNA

Clrn3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
AffiniPure Rabbit Goat IgG (H+L) Secondary Antibody (HRP)
orb1474912-01 0.5 mL

AffiniPure Rabbit Goat IgG (H+L) Secondary Antibody (HRP)

Sign In for Pricing
View Details
AffiniPure Rabbit Goat IgG (H+L) Secondary Antibody (HRP)
orb1474912-02 1 mL

AffiniPure Rabbit Goat IgG (H+L) Secondary Antibody (HRP)

Sign In for Pricing
View Details
Human TTC39A Protein Lysate 20ug
IHUTTC39APLLY20UG 20 µg

Human TTC39A Protein Lysate 20ug

Sign In for Pricing
View Details
Vcan ORF Vector (Rat) (pORF)
ORF078771 1.0 µg DNA

Vcan ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details