Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOB1 Peptide - N-terminal region

TOB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TOB1, TOB, TROB1

UniProt

P50616

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOB1 Rabbit Polyclonal Antibody (orb581572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005740

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFN a 1 Human
OM297268-01 20 µg

IFN a 1 Human

Sign In for Pricing
View Details
IFN a 1 Human
OM297268-02 5 µg

IFN a 1 Human

Sign In for Pricing
View Details
IFN a 1 Human
OM297268-03 1 mg

IFN a 1 Human

Sign In for Pricing
View Details
PDE1A Protein Vector (Rat) (pPB-N-His)
PV293023 500 ng

PDE1A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
WNT3 Protein Vector (Human) (pPB-C-His)
PV143718 500 ng

WNT3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
IgG, IgA, IgM H&L (Biotin)
MBS623329-01 2 mg

IgG, IgA, IgM H&L (Biotin)

Sign In for Pricing
View Details