Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL18 Peptide - C-terminal region

RPL18 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RPL18

UniProt

Q07020

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL18 Rabbit Polyclonal Antibody (orb583015) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000970

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken DDT (D-Dopachrome Tautomerase) ELISA Kit
MBS2501176-01 24 Tests

Chicken DDT (D-Dopachrome Tautomerase) ELISA Kit

Sign In for Pricing
View Details
Chicken DDT (D-Dopachrome Tautomerase) ELISA Kit
MBS2501176-02 48 Tests

Chicken DDT (D-Dopachrome Tautomerase) ELISA Kit

Sign In for Pricing
View Details
Chicken DDT (D-Dopachrome Tautomerase) ELISA Kit
MBS2501176-03 96 Tests

Chicken DDT (D-Dopachrome Tautomerase) ELISA Kit

Sign In for Pricing
View Details
Chicken DDT (D-Dopachrome Tautomerase) ELISA Kit
MBS2501176-04 5x 96 Tests

Chicken DDT (D-Dopachrome Tautomerase) ELISA Kit

Sign In for Pricing
View Details
Chicken DDT (D-Dopachrome Tautomerase) ELISA Kit
MBS2501176-05 10x 96 Tests

Chicken DDT (D-Dopachrome Tautomerase) ELISA Kit

Sign In for Pricing
View Details
GJD2 Protein Vector (Rat) (pPM-C-HA)
21553026 500 ng

GJD2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details