Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR5B Peptide - N-terminal region

WDR5B Peptide - N-terminal region

Product Specifications

Product Name Alternative

WDR5B

UniProt

Q86VZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR5B Rabbit Polyclonal Antibody (orb583527) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061942

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal EI2BL Antibody [Alexa Fluor 405]
NBP3-06310AF405 0.1 mL

Rabbit Polyclonal EI2BL Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Lentiviral mouse Sult2a4 shRNA (UAS) - Lentiviral mouse Sult2a4 shRNA (UAS, iRFP) plasmid
GTR15180184 1 Vial

Lentiviral mouse Sult2a4 shRNA (UAS) - Lentiviral mouse Sult2a4 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal SNN Antibody
NBP1-91104 0.1 mL

Rabbit Polyclonal SNN Antibody

Sign In for Pricing
View Details
Recombinant Clostridium phytofermentans UPF0133 protein Cphy_0047 (Cphy_0047)
MBS1219346-01 0.02 mg (E-Coli)

Recombinant Clostridium phytofermentans UPF0133 protein Cphy_0047 (Cphy_0047)

Sign In for Pricing
View Details
Recombinant Clostridium phytofermentans UPF0133 protein Cphy_0047 (Cphy_0047)
MBS1219346-02 0.1 mg (E-Coli)

Recombinant Clostridium phytofermentans UPF0133 protein Cphy_0047 (Cphy_0047)

Sign In for Pricing
View Details
Recombinant Clostridium phytofermentans UPF0133 protein Cphy_0047 (Cphy_0047)
MBS1219346-03 0.02 mg (Yeast)

Recombinant Clostridium phytofermentans UPF0133 protein Cphy_0047 (Cphy_0047)

Sign In for Pricing
View Details