Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR5B Peptide - N-terminal region

WDR5B Peptide - N-terminal region

Product Specifications

Product Name Alternative

WDR5B

UniProt

Q86VZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR5B Rabbit Polyclonal Antibody (orb583527) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061942

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hu CD268 APC
MBS1801855-01 100 Tests

Anti-Hu CD268 APC

Sign In for Pricing
View Details
Anti-Hu CD268 APC
MBS1801855-02 5x 100 Tests

Anti-Hu CD268 APC

Sign In for Pricing
View Details
Rabbit Polyclonal OR4D10 Antibody
NBP3-09784-100ul 100 µL

Rabbit Polyclonal OR4D10 Antibody

Sign In for Pricing
View Details
Ccne2 Mouse shRNA Plasmid (Locus ID 12448)
TL515495 1 Kit

Ccne2 Mouse shRNA Plasmid (Locus ID 12448)

Sign In for Pricing
View Details
Recombinant human Vasopressin-neurophysin II-copeptin protein, C-His (HEK293)
orb1974348-01 20 µg

Recombinant human Vasopressin-neurophysin II-copeptin protein, C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human Vasopressin-neurophysin II-copeptin protein, C-His (HEK293)
orb1974348-02 100 µg

Recombinant human Vasopressin-neurophysin II-copeptin protein, C-His (HEK293)

Sign In for Pricing
View Details